DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aps and NUDX13

DIOPT Version :9

Sequence 1:NP_648421.1 Gene:Aps / 39226 FlyBaseID:FBgn0036111 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_189303.1 Gene:NUDX13 / 822281 AraportID:AT3G26690 Length:202 Species:Arabidopsis thaliana


Alignment Length:141 Identity:44/141 - (31%)
Similarity:64/141 - (45%) Gaps:30/141 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 YDKDGFRRRAACI-------------CVKSENEAEVLLVTSSRRPELWIVPGGGVEPEEESSVTA 63
            || :.||..:.||             .|..||:.:||:::|..|.:| :.|.||.|.:|.....|
plant    15 YD-NNFRLVSGCIPYRLVKDEEEDSTSVDFENKLQVLMISSPNRHDL-VFPKGGWEDDETVLEAA 77

  Fly    64 VREVLEEAGVVGDLGR-CLGVFENNDHMHRTE------------VFVMNVTQELDEWEDSRSIGR 115
            .||.:|||||.|.|.. .|||:|........|            :|.:.|.:||..|.:...  |
plant    78 SREAMEEAGVKGILREDPLGVWEFRSKSSSVEADCCLGGGCKGYMFALEVKEELAIWPEQDD--R 140

  Fly   116 KRQWFTIDDAL 126
            :|:|..:.:||
plant   141 ERRWLNVKEAL 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ApsNP_648421.1 Nudix_Hydrolase_9 19..137 CDD:240024 40/134 (30%)
NUDX13NP_189303.1 Nudix_Hydrolase_9 21..160 CDD:240024 40/134 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 59 1.000 Domainoid score I3889
eggNOG 1 0.900 - - E1_COG0494
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 64 1.000 Inparanoid score I2515
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1324716at2759
OrthoFinder 1 1.000 - - FOG0000621
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101097
Panther 1 1.100 - - O PTHR12629
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.830

Return to query results.
Submit another query.