DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aps and NUDT16

DIOPT Version :9

Sequence 1:NP_648421.1 Gene:Aps / 39226 FlyBaseID:FBgn0036111 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_566428.1 Gene:NUDT16 / 820440 AraportID:AT3G12600 Length:180 Species:Arabidopsis thaliana


Alignment Length:134 Identity:44/134 - (32%)
Similarity:66/134 - (49%) Gaps:24/134 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 KDGFRRRAACI---CVKSENEA--------EVLLVTSSRRPELWIVPGGGVEPEEESSVTAVREV 67
            :||.|..|.||   .|.|:.:.        :||:::||..|.| :.|.||.|.:|.....|.||.
plant    16 EDGSRLVAGCIPFRYVNSDKDGNSESGKVIQVLMISSSSGPGL-LFPKGGWENDETVREAAAREA 79

  Fly    68 LEEAGVVGDLGRCLGVFENNDHMHRTE----------VFVMNVTQELDEWEDSRSIGRKRQWFTI 122
            :|||||.|.|...||.:|.....|:.|          ::.:.|.:||..|.:..:  |.|:|.||
plant    80 VEEAGVRGILMDFLGNYEFKSKSHQDEFSPEGLCKAAMYALYVKEELATWPEHET--RTRKWLTI 142

  Fly   123 DDAL 126
            ::|:
plant   143 EEAV 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ApsNP_648421.1 Nudix_Hydrolase_9 19..137 CDD:240024 41/129 (32%)
NUDT16NP_566428.1 Nudix_Hydrolase_9 21..155 CDD:240024 41/129 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 59 1.000 Domainoid score I3889
eggNOG 1 0.900 - - E1_COG0494
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 64 1.000 Inparanoid score I2515
OMA 1 1.010 - - QHG58445
OrthoDB 1 1.010 - - D1324716at2759
OrthoFinder 1 1.000 - - FOG0000621
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101097
Panther 1 1.100 - - O PTHR12629
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.840

Return to query results.
Submit another query.