DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aps and NUDT5

DIOPT Version :9

Sequence 1:NP_648421.1 Gene:Aps / 39226 FlyBaseID:FBgn0036111 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_178524.2 Gene:NUDT5 / 814983 AraportID:AT2G04430 Length:302 Species:Arabidopsis thaliana


Alignment Length:103 Identity:24/103 - (23%)
Similarity:47/103 - (45%) Gaps:7/103 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 EVLLVTSS----RRPELWIVPGGGVEPEEESSVTAVREVLEEAGVVGDLGRCLGVFENNDHM--H 91
            |:|:|..:    :...:|.||.|.::..|.....|||||.||..:..:....|...|::..:  .
plant   137 EMLVVQENSGYFKDKNVWKVPTGTIKEGESIWAGAVREVKEETDIDAEFVEVLSFMESHQAVWQR 201

  Fly    92 RTEV-FVMNVTQELDEWEDSRSIGRKRQWFTIDDALSQ 128
            :|:: ||..:.....|.:...|.....:|..:::.::|
plant   202 KTDIFFVCELEARTFEIQKQDSEIHAAKWMPVEEYVNQ 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ApsNP_648421.1 Nudix_Hydrolase_9 19..137 CDD:240024 24/103 (23%)
NUDT5NP_178524.2 Nudix_Hydrolase 123..257 CDD:294304 24/103 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.