DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aps and Nudt3

DIOPT Version :9

Sequence 1:NP_648421.1 Gene:Aps / 39226 FlyBaseID:FBgn0036111 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_062811.1 Gene:Nudt3 / 56409 MGIID:1928484 Length:168 Species:Mus musculus


Alignment Length:160 Identity:92/160 - (57%)
Similarity:117/160 - (73%) Gaps:0/160 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVKEKPNSTRIYDKDGFRRRAACICVKSENEAEVLLVTSSRRPELWIVPGGGVEPEEESSVTAVR 65
            |:|.|.|.||.||.||:::||||:|.:||:|.|||||:|||.|:.|||||||:|||||.||.|||
Mouse     1 MMKLKSNQTRTYDGDGYKKRAACLCFRSESEEEVLLVSSSRHPDRWIVPGGGMEPEEEPSVAAVR 65

  Fly    66 EVLEEAGVVGDLGRCLGVFENNDHMHRTEVFVMNVTQELDEWEDSRSIGRKRQWFTIDDALSQLA 130
            ||.|||||.|.|||.:|:|||.:..|||.|:|:.||:.|::||||.:|||||:||.|:||:..|.
Mouse    66 EVCEEAGVKGTLGRLVGIFENQERKHRTYVYVLIVTEVLEDWEDSVNIGRKREWFKIEDAIKVLQ 130

  Fly   131 LHKPTQQHYLMQLQHSKTLDNTNRVVNATH 160
            .|||.|..|...|:.....:|...||..|:
Mouse   131 CHKPVQASYFETLRQGYPANNGTPVVPTTY 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ApsNP_648421.1 Nudix_Hydrolase_9 19..137 CDD:240024 75/117 (64%)
Nudt3NP_062811.1 Substrate binding. /evidence=ECO:0000250|UniProtKB:O95989 18..20 0/1 (0%)
Nudix_Hydrolase_9 19..134 CDD:240024 73/114 (64%)
Substrate binding. /evidence=ECO:0000250|UniProtKB:O95989 39..41 1/1 (100%)
Nudix box 51..72 16/20 (80%)
Substrate binding. /evidence=ECO:0000250|UniProtKB:O95989 89..91 0/1 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 159 1.000 Domainoid score I4070
eggNOG 1 0.900 - - E1_COG0494
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H31400
Inparanoid 1 1.050 193 1.000 Inparanoid score I3835
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG58445
OrthoDB 1 1.010 - - D1324716at2759
OrthoFinder 1 1.000 - - FOG0000621
OrthoInspector 1 1.000 - - otm43498
orthoMCL 1 0.900 - - OOG6_101097
Panther 1 1.100 - - LDO PTHR12629
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R74
SonicParanoid 1 1.000 - - X795
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.870

Return to query results.
Submit another query.