DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aps and Nudt5

DIOPT Version :9

Sequence 1:NP_648421.1 Gene:Aps / 39226 FlyBaseID:FBgn0036111 Length:177 Species:Drosophila melanogaster
Sequence 2:XP_036018286.1 Gene:Nudt5 / 53893 MGIID:1858232 Length:264 Species:Mus musculus


Alignment Length:143 Identity:33/143 - (23%)
Similarity:50/143 - (34%) Gaps:38/143 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 VLLVTSSRRP------ELWIVPGGGVEPEEESSVTAVREVLEEAGVVGDLGRCLGVFENNDHMHR 92
            |:||...|.|      |.   |.|.:|..|.....|:||:.||.|..|::..|......:..:..
Mouse   122 VILVKQFRPPMGSYCLEF---PAGFIEDGESPEAAALRELEEETGYKGEVAECSPAVCMDPGLSN 183

  Fly    93 TEVFVMNVTQELDEWEDSRSIGR-------------KRQWFTIDDALSQLALHKPTQQH------ 138
            ....|:.||...|:..:.|...:             |....|..|||.       .:||      
Mouse   184 CTTHVVTVTINGDDAGNVRPKPKPGDGEFMEVISLPKNDLLTRLDALG-------AEQHLTVDAK 241

  Fly   139 ---YLMQLQHSKT 148
               |.:.|:|:.:
Mouse   242 VYAYGLALKHANS 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ApsNP_648421.1 Nudix_Hydrolase_9 19..137 CDD:240024 28/121 (23%)
Nudt5XP_036018286.1 ADPRase_NUDT5 105..252 CDD:239516 32/139 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0494
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.