DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aps and nudt4b

DIOPT Version :9

Sequence 1:NP_648421.1 Gene:Aps / 39226 FlyBaseID:FBgn0036111 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_001004648.1 Gene:nudt4b / 447910 ZFINID:ZDB-GENE-040912-79 Length:178 Species:Danio rerio


Alignment Length:175 Identity:98/175 - (56%)
Similarity:128/175 - (73%) Gaps:3/175 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VKEKPNSTRIYDKDGFRRRAACICVKSENEAEVLLVTSSRRPELWIVPGGGVEPEEESSVTAVRE 66
            :|.|||.||.||::||:|||||:|.|::.|.|||||:|||.|:.|||||||:|||||....||||
Zfish     1 MKFKPNQTRTYDREGFKRRAACLCFKNDREDEVLLVSSSRNPDQWIVPGGGMEPEEEPCGAAVRE 65

  Fly    67 VLEEAGVVGDLGRCLGVFE-NNDHMHRTEVFVMNVTQELDEWEDSRSIGRKRQWFTIDDALSQLA 130
            |.|||||.|.|||.||||| |.|..|||.|:|:.||:.||.||||.:|||||:||::|:|:..|.
Zfish    66 VYEEAGVKGKLGRLLGVFEQNQDRKHRTYVYVLTVTETLDAWEDSVNIGRKREWFSVDEAIRVLQ 130

  Fly   131 LHKPTQQHYLMQLQHSKTLD-NTNRVVNATHPPKLTNA-ATPAAS 173
            .|||....||.:|:.:::.. |.|.::..|:|..||.. :|||::
Zfish   131 GHKPVHAEYLRRLRINRSSSTNGNLLLPQTNPSNLTPLFSTPASA 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ApsNP_648421.1 Nudix_Hydrolase_9 19..137 CDD:240024 76/118 (64%)
nudt4bNP_001004648.1 Nudix_Hydrolase_9 18..127 CDD:240024 72/108 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170593311
Domainoid 1 1.000 156 1.000 Domainoid score I4138
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 193 1.000 Inparanoid score I3833
OMA 1 1.010 - - QHG58445
OrthoDB 1 1.010 - - D1324716at2759
OrthoFinder 1 1.000 - - FOG0000621
OrthoInspector 1 1.000 - - otm24589
orthoMCL 1 0.900 - - OOG6_101097
Panther 1 1.100 - - O PTHR12629
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R74
SonicParanoid 1 1.000 - - X795
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1413.940

Return to query results.
Submit another query.