DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aps and NUDT4B

DIOPT Version :9

Sequence 1:NP_648421.1 Gene:Aps / 39226 FlyBaseID:FBgn0036111 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_001342336.1 Gene:NUDT4B / 440672 HGNCID:18012 Length:181 Species:Homo sapiens


Alignment Length:179 Identity:97/179 - (54%)
Similarity:123/179 - (68%) Gaps:8/179 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVKEKPNSTRIYDKDGFRRRAACICVKSENEAEVLLVTSSRRPELWIVPGGGVEPEEESSVTAVR 65
            |:|.|||.||.||::||::||||:|.:||.|.|||||:|||.|:.|||||||:|||||....|||
Human     1 MMKFKPNQTRTYDREGFKKRAACLCFRSEQEDEVLLVSSSRYPDQWIVPGGGMEPEEEPGGAAVR 65

  Fly    66 EVLEEAGVVGDLGRCLGVFE-NNDHMHRTEVFVMNVTQELDEWEDSRSIGRKRQWFTIDDALSQL 129
            ||.|||||.|.|||.||:|| |.|..|||.|:|:.||:.|::||||.:|||||:||.::||:..|
Human    66 EVYEEAGVKGKLGRLLGIFEQNQDRKHRTYVYVLTVTEILEDWEDSVNIGRKREWFKVEDAIKVL 130

  Fly   130 ALHKPTQQHYLMQLQHSKTLDNTNRVVNATHPPKL--TNAATPAASPTT 176
            ..|||....||.:|:...:..|.|..|     |.|  .||....|:.|:
Human   131 QCHKPVHAEYLEKLKLGCSPANGNSTV-----PSLPDNNALFVTAAQTS 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ApsNP_648421.1 Nudix_Hydrolase_9 19..137 CDD:240024 74/118 (63%)
NUDT4BNP_001342336.1 Substrate binding. /evidence=ECO:0000250|UniProtKB:O95989 18..20 0/1 (0%)
Nudix_Hydrolase_9 19..138 CDD:240024 74/118 (63%)
Substrate binding. /evidence=ECO:0000250|UniProtKB:O95989 39..41 1/1 (100%)
Nudix box. /evidence=ECO:0000255|PROSITE-ProRule:PRU00794 51..72 14/20 (70%)
Substrate binding. /evidence=ECO:0000250|UniProtKB:O95989 90..92 0/1 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157545
Domainoid 1 1.000 159 1.000 Domainoid score I4083
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 193 1.000 Inparanoid score I3846
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG58445
OrthoDB 1 1.010 - - D1324716at2759
OrthoFinder 1 1.000 - - FOG0000621
OrthoInspector 1 1.000 - - otm41446
orthoMCL 1 0.900 - - OOG6_101097
Panther 1 1.100 - - O PTHR12629
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R74
SonicParanoid 1 1.000 - - X795
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1312.940

Return to query results.
Submit another query.