DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aps and DCP2

DIOPT Version :10

Sequence 1:NP_648421.1 Gene:Aps / 39226 FlyBaseID:FBgn0036111 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_001246776.1 Gene:DCP2 / 39722 FlyBaseID:FBgn0036534 Length:792 Species:Drosophila melanogaster


Alignment Length:166 Identity:43/166 - (25%)
Similarity:70/166 - (42%) Gaps:24/166 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 SENEAEVLLVTSSRRPELWIVPGGGVEPEEESSVTAVREVLEEAGV-VGDLGRCLGVFENNDHMH 91
            ||:....|||.|......|..|.|.:...|:.:..|.|||.||.|. :.||      .:.||::.
  Fly   319 SEDHNHCLLVQSYFARNSWGFPKGKINENEDPAHCATREVYEETGFDITDL------IDANDYIE 377

  Fly    92 R------TEVFVM-NVTQELDEWEDSRSIGRKRQWFTID-------DALSQLALHKPTQQHYLMQ 142
            .      |.::|: |:..:......:|:..:...||.||       ||:|:..|.|.:...:::.
  Fly   378 AFINYQYTRLYVVRNIPMDTQFAPRTRNEIKCCDWFRIDALPVNKNDAISKAKLGKTSNSFFMIM 442

  Fly   143 --LQHSKTLDNTNRVVNATHPPKLTNAATP-AASPT 175
              ::..|...|..:........|.:...:| |||||
  Fly   443 PFVKRLKKWVNDRKAGIEPRRRKFSGQQSPKAASPT 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ApsNP_648421.1 NUDIX_DIPP2_like_Nudt4 19..143 CDD:467551 34/131 (26%)
DCP2NP_001246776.1 DCP2 212..306 CDD:428265
NUDIX_Dcp2p_Nudt20 310..458 CDD:467540 36/144 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.