DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aps and nudt3a

DIOPT Version :9

Sequence 1:NP_648421.1 Gene:Aps / 39226 FlyBaseID:FBgn0036111 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_957439.2 Gene:nudt3a / 394120 ZFINID:ZDB-GENE-040426-792 Length:170 Species:Danio rerio


Alignment Length:160 Identity:93/160 - (58%)
Similarity:114/160 - (71%) Gaps:1/160 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVKEKPNSTRIYDKDGFRRRAACICVKSENEAEVLLVTSSRRPELWIVPGGGVEPEEESSVTAVR 65
            |:|.|.|.||.||:||:::||||:|.:||.|.|||||:||..|:.|||||||:|||||.||.|||
Zfish     1 MIKLKSNQTRTYDRDGYKKRAACLCFRSEREEEVLLVSSSSHPDRWIVPGGGMEPEEEPSVAAVR 65

  Fly    66 EVLEEAGVVGDLGRCLGVFENNDHMHRTEVFVMNVTQELDEWEDSRSIGRKRQWFTIDDALSQLA 130
            ||.|||||.|.|||.:|||||.|..|||.|:|:.||:.|::||||.:|||||:||..:||...|.
Zfish    66 EVCEEAGVKGTLGRLVGVFENRDRKHRTYVYVLIVTEVLEDWEDSVNIGRKREWFKTEDARRVLQ 130

  Fly   131 LHKPTQQHYLMQLQHSKTLDNTNRVVNATH 160
            .|||.|..|...||......|...:| ||:
Zfish   131 CHKPVQASYFEALQQDCMTSNGTSLV-ATY 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ApsNP_648421.1 Nudix_Hydrolase_9 19..137 CDD:240024 75/117 (64%)
nudt3aNP_957439.2 Nudix_Hydrolase_9 19..134 CDD:240024 73/114 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 156 1.000 Domainoid score I4138
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 193 1.000 Inparanoid score I3833
OMA 1 1.010 - - QHG58445
OrthoDB 1 1.010 - - D1324716at2759
OrthoFinder 1 1.000 - - FOG0000621
OrthoInspector 1 1.000 - - otm24589
orthoMCL 1 0.900 - - OOG6_101097
Panther 1 1.100 - - O PTHR12629
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R74
SonicParanoid 1 1.000 - - X795
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1212.010

Return to query results.
Submit another query.