DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aps and nudt4a

DIOPT Version :9

Sequence 1:NP_648421.1 Gene:Aps / 39226 FlyBaseID:FBgn0036111 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_001296990.1 Gene:nudt4a / 378990 ZFINID:ZDB-GENE-031010-33 Length:226 Species:Danio rerio


Alignment Length:179 Identity:96/179 - (53%)
Similarity:118/179 - (65%) Gaps:14/179 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVKEKPNSTRIYDKDGFRRRAACICVKSENEAEVLLVTSSRRPELWIVPGGGVEPEEESSVTAVR 65
            |:|.|||.||.||.:||::||||:|.|::.|.|||||:|||.|:.|||||||:|||||....|||
Zfish    44 MMKFKPNQTRTYDGEGFKKRAACLCFKNDREDEVLLVSSSRHPDQWIVPGGGMEPEEEPGGAAVR 108

  Fly    66 EVLEEAGVVGDLGRCLGVFE-NNDHMHRTEVFVMNVTQELDEWEDSRSIGRKRQWFTIDDALSQL 129
            ||.|||||.|.|||.||||| |.|..|||.|:|:.||:.|::||||.:|||||:||.||:|:..|
Zfish   109 EVYEEAGVRGTLGRLLGVFEQNQDSKHRTYVYVLTVTETLEDWEDSVNIGRKRKWFKIDEAIRVL 173

  Fly   130 ALHKPTQQHYLMQL-------------QHSKTLDNTNRVVNATHPPKLT 165
            ..|||....||.:|             ....|.||.:....|:|...||
Zfish   174 QCHKPFHAEYLRKLTPRCGPTNGNTQEPTMNTDDNASLRQTASHDCGLT 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ApsNP_648421.1 Nudix_Hydrolase_9 19..137 CDD:240024 75/118 (64%)
nudt4aNP_001296990.1 Nudix_Hydrolase_9 62..178 CDD:240024 73/115 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170593312
Domainoid 1 1.000 156 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0494
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 193 1.000 Inparanoid score I3833
OMA 1 1.010 - - QHG58445
OrthoDB 1 1.010 - - D1324716at2759
OrthoFinder 1 1.000 - - FOG0000621
OrthoInspector 1 1.000 - - otm24589
orthoMCL 1 0.900 - - OOG6_101097
Panther 1 1.100 - - O PTHR12629
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R74
SonicParanoid 1 1.000 - - X795
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.