DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aps and CG10194

DIOPT Version :9

Sequence 1:NP_648421.1 Gene:Aps / 39226 FlyBaseID:FBgn0036111 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_609973.1 Gene:CG10194 / 35231 FlyBaseID:FBgn0032790 Length:351 Species:Drosophila melanogaster


Alignment Length:294 Identity:53/294 - (18%)
Similarity:84/294 - (28%) Gaps:143/294 - (48%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 RRAACICVKSENEAE--------VLLVTSSRR----PELWIVPGG-------------------- 51
            |.::.:.:.::|:.|        .||:|.:::    ||..:.|||                    
  Fly     9 RSSSSLILLAKNQVEKSTSCDYNALLLTRTQKSTFMPESSVFPGGVCDASDSSPAWLEHFQRNEF 73

  Fly    52 --------------------------GVEPEEESSVTAVREVLEEAGVV-----------GDLGR 79
                                      .::|.....:||:||..||.|::           .|.| 
  Fly    74 SAAKLRNVGHVKGPRPDIFHTKADKKSLDPSLALRLTAIRETFEELGILLCRDSKSLTSTSDYG- 137

  Fly    80 CLGVFENNDHMHRTEVFVMNVTQ---------------ELDEWEDSR--SIGRKR---------- 117
              ..::..|..|...:...|.:|               .|.||...|  |..:||          
  Fly   138 --AFYDQFDRAHWQHIVHNNASQFLELCKQLDVLPDVWSLHEWSVWRTPSTFKKRFETAFFMTAL 200

  Fly   118 ----------------QWFTIDDALSQLALHK-----PTQQHYLMQLQHSKTLDNTNRV------ 155
                            .|.:..|.| |.:|.|     |.|.:.|.:..:..:|||..:.      
  Fly   201 EQEPRVHIEPNEVKDSAWRSPLDYL-QASLRKELWLPPPQFYELSRCLNFSSLDNLRQFAAEREV 264

  Fly   156 --VNATHP--PKLTNA------------ATPAAS 173
              :...||  .|.||.            |.|.||
  Fly   265 KGIQLIHPVVHKCTNGLVHLLPGDDAYPADPDAS 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ApsNP_648421.1 Nudix_Hydrolase_9 19..137 CDD:240024 39/234 (17%)
CG10194NP_609973.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0494
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.