DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aps and CG12567

DIOPT Version :9

Sequence 1:NP_648421.1 Gene:Aps / 39226 FlyBaseID:FBgn0036111 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_001015384.1 Gene:CG12567 / 3355094 FlyBaseID:FBgn0039958 Length:349 Species:Drosophila melanogaster


Alignment Length:185 Identity:39/185 - (21%)
Similarity:68/185 - (36%) Gaps:54/185 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 DKDGFRRR---AACICVKSENEAEVLLVTSSRRPELW-IVPGGGVEPEEESSVTAVREVLEEAGV 73
            |.:|:.|.   ..||.::..:.      |....|..| .:.|||:........||::|..|||.:
  Fly   140 DINGYVRHPTLGLCIWLQQRSN------TKETWPGKWDNMVGGGLSVGFGIKETAIKEAAEEASI 198

  Fly    74 VGDLGRCL--------------GVFENNDHMHRTEV---FV-MNVTQELDEWE------------ 108
            ..||.:.|              |:|.|.:::...|:   || .|...|:..:|            
  Fly   199 PSDLVKNLVSAGCVSFYFESRQGLFPNTEYVFDLELPLDFVPQNADGEVQAFELLTAKDCVERVF 263

  Fly   109 --DSRSIGR--------KRQWFTIDDAL--SQLA--LHKPTQQHYLMQLQHSKTL 149
              |.::...        :....|.||.:  :|:.  ||.|.|..|..:.:..:::
  Fly   264 TSDFKTTSAPVVIDFLIRHGHITADDVVDFTQIVELLHVPLQSIYTYKTRFEQSI 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ApsNP_648421.1 Nudix_Hydrolase_9 19..137 CDD:240024 35/165 (21%)
CG12567NP_001015384.1 DUF4743 11..136 CDD:292538
Nudix_hydrolase_3 106..283 CDD:239648 30/148 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0494
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.