DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aps and NUDT7

DIOPT Version :9

Sequence 1:NP_648421.1 Gene:Aps / 39226 FlyBaseID:FBgn0036111 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_001099133.1 Gene:NUDT7 / 283927 HGNCID:8054 Length:238 Species:Homo sapiens


Alignment Length:162 Identity:39/162 - (24%)
Similarity:54/162 - (33%) Gaps:54/162 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 VKSENEAEVLLVTSS----RRPELWIVPGGGVEPEE-ESSVTAVREVLEEAG-------VVGDLG 78
            |..|.:..:|....|    |.|.....|||..:|.: :.:.||:||..||.|       ||..|.
Human    47 VAKEGKLHLLFTVRSEKLRRAPGEVCFPGGKRDPTDMDDAATALREAQEEVGLRPHQVEVVCCLV 111

  Fly    79 RCL-----------GVFENNDHMHRTEVFVMNVTQELDEWEDSRSIGRKRQWFTIDDALSQLA-- 130
            .||           |:.::|.........|.:|                        .|..||  
Human   112 PCLIDTDTLITPFVGLIDHNFQAQPNPAEVKDV------------------------FLVPLAYF 152

  Fly   131 LHKPT-QQHYLMQLQHSKTLDNTNRVVNATHP 161
            ||... .|||:.:|.|.    ..|.:...|:|
Human   153 LHPQVHDQHYVTRLGHR----FINHIFEYTNP 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ApsNP_648421.1 Nudix_Hydrolase_9 19..137 CDD:240024 31/136 (23%)
NUDT7NP_001099133.1 CoAse 41..201 CDD:239518 39/162 (24%)
Nudix box 77..98 7/20 (35%)
Microbody targeting signal. /evidence=ECO:0000250 236..238
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0494
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.