DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aps and aps1

DIOPT Version :9

Sequence 1:NP_648421.1 Gene:Aps / 39226 FlyBaseID:FBgn0036111 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_592840.1 Gene:aps1 / 2542890 PomBaseID:SPAC13G6.14 Length:210 Species:Schizosaccharomyces pombe


Alignment Length:175 Identity:45/175 - (25%)
Similarity:74/175 - (42%) Gaps:46/175 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 RRAACICVKSENEAEVLLVTSSRRPELWIVPGGGVEPEEESSVTAVREVLEEAGVVGDLGRCLGV 83
            |.||.:...|.::.:||||:|:::...|:||.||.|.:|.....|:||..||.|:||.:.|.||.
pombe    42 RLAAGVVALSADKRKVLLVSSAKKHPSWVVPKGGWEADESVQQAALREGWEEGGLVGHITRSLGS 106

  Fly    84 FEN-----------------------NDHMHRTEV-----------------FVMNVTQELDEWE 108
            |::                       ||....||:                 |.:.|.:..|.:.
pombe   107 FKDKRPTDTIDRRKKYLKQLMSKSSGNDVSTNTELGAEAEKLLLPPRAECEFFEVIVERLEDNYP 171

  Fly   109 DSRSIGRKRQWFTIDDALSQLALHKPTQQHYLMQLQHSKTLDNTN 153
            :.|.  |:|:|.:..:|...|.    :::..|..|:.|..:...|
pombe   172 EMRK--RRRKWMSYQEAKEALT----SRKDILAALEKSSIIKEEN 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ApsNP_648421.1 Nudix_Hydrolase_9 19..137 CDD:240024 41/157 (26%)
aps1NP_592840.1 Nudix_Hydrolase_9 43..198 CDD:240024 40/160 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I3237
eggNOG 1 0.900 - - E1_COG0494
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG58445
OrthoFinder 1 1.000 - - FOG0000621
OrthoInspector 1 1.000 - - oto101353
orthoMCL 1 0.900 - - OOG6_101097
Panther 1 1.100 - - LDO PTHR12629
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R74
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.810

Return to query results.
Submit another query.