DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aps and ndx-7

DIOPT Version :9

Sequence 1:NP_648421.1 Gene:Aps / 39226 FlyBaseID:FBgn0036111 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_491336.2 Gene:ndx-7 / 183413 WormBaseID:WBGene00003584 Length:295 Species:Caenorhabditis elegans


Alignment Length:198 Identity:42/198 - (21%)
Similarity:68/198 - (34%) Gaps:58/198 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 RRAACICVKSENEAEVLLV----TSSRRPELWIVPGGGVEPE-----EESSVTAVREVLEEAGVV 74
            |.||.|.:..:....||::    |:...|...:.|||.|:..     :|..:.||||:.||:||:
 Worm    11 RSAASIILACKTTRRVLMLKRGTTAKFMPNTMVFPGGVVDKTDAKLGDEFRIAAVRELFEESGVL 75

  Fly    75 GDLGRCLG--VFENNDHMHRTEVFVMNVTQELD------------EW------------------ 107
            ....   |  ...||..|...:..::|.|.:.:            ||                  
 Worm    76 STKN---GWQTSANNPDMTSLKADIVNDTSKFEQLSGTICADNLIEWDTFITPANYPRRFLTKFY 137

  Fly   108 ----EDSRSIG------RKRQWF----TIDDALSQLALHKPTQQHYLMQLQHSKTLDNTNRVVNA 158
                :|..:|.      .:..|.    .:|:|.:......|.|.:.|.:|...|..|...:..|.
 Worm   138 LMLVDDEPAIDLCTSEMSEYNWIEPKECVDEAYAGKYALPPPQVYELTRLSQVKDWDLCEKYGNV 202

  Fly   159 THP 161
            ..|
 Worm   203 KKP 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ApsNP_648421.1 Nudix_Hydrolase_9 19..137 CDD:240024 35/172 (20%)
ndx-7NP_491336.2 NUDIX 10..173 CDD:278710 34/164 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0494
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.