DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aps and Nudt1

DIOPT Version :9

Sequence 1:NP_648421.1 Gene:Aps / 39226 FlyBaseID:FBgn0036111 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_001343512.1 Gene:Nudt1 / 17766 MGIID:109280 Length:156 Species:Mus musculus


Alignment Length:93 Identity:27/93 - (29%)
Similarity:36/93 - (38%) Gaps:30/93 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 WIVPGGGVEPEEESSVTAVREVLEEAGVVGDLGRCLG--VFE-------------NNDHMHRTEV 95
            |...||.|:..|.....|.||:|||:|:..|....:|  .||             :.||:|.|..
Mouse    32 WNGFGGKVQEGETIEDGAKRELLEESGLSVDTLHKVGHISFEFVGSPELMDVHIFSADHVHGTPT 96

  Fly    96 FVMNVTQELDEWEDSRSIGRKRQWFTID 123
                      |.|:.|.     |||.:|
Mouse    97 ----------ESEEMRP-----QWFQLD 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ApsNP_648421.1 Nudix_Hydrolase_9 19..137 CDD:240024 27/93 (29%)
Nudt1NP_001343512.1 MTH1 6..140 CDD:239519 27/93 (29%)
Substrate binding. /evidence=ECO:0000269|PubMed:29281266, ECO:0007744|PDB:5MZE 35..38 1/2 (50%)
Nudix box. /evidence=ECO:0000255|PROSITE-ProRule:PRU00794 37..58 9/20 (45%)
Substrate binding. /evidence=ECO:0000269|PubMed:29281266, ECO:0007744|PDB:5MZE 117..120
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0494
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.