DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aps and NUDT5

DIOPT Version :9

Sequence 1:NP_648421.1 Gene:Aps / 39226 FlyBaseID:FBgn0036111 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_054861.2 Gene:NUDT5 / 11164 HGNCID:8052 Length:219 Species:Homo sapiens


Alignment Length:83 Identity:20/83 - (24%)
Similarity:39/83 - (46%) Gaps:4/83 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 EVLLVTSSRRPEL--WIV--PGGGVEPEEESSVTAVREVLEEAGVVGDLGRCLGVFENNDHMHRT 93
            |.:::....||.:  :.:  |.|.::..|.....|:||:.||.|..||:..|......:..:...
Human    75 ECIVLVKQFRPPMGGYCIEFPAGLIDDGETPEAAALRELEEETGYKGDIAECSPAVCMDPGLSNC 139

  Fly    94 EVFVMNVTQELDEWEDSR 111
            .:.::.||...|:.|::|
Human   140 TIHIVTVTINGDDAENAR 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ApsNP_648421.1 Nudix_Hydrolase_9 19..137 CDD:240024 20/83 (24%)
NUDT5NP_054861.2 Substrate binding, shared with dimeric partner. /evidence=ECO:0000269|PubMed:17052728, ECO:0000269|PubMed:18462755, ECO:0000269|PubMed:21768126 46..47
ADPRase_NUDT5 60..207 CDD:239516 20/83 (24%)
Nudix box 97..118 7/20 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0494
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.