DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aps and Nudt10

DIOPT Version :9

Sequence 1:NP_648421.1 Gene:Aps / 39226 FlyBaseID:FBgn0036111 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_001026834.1 Gene:Nudt10 / 102954 MGIID:2147931 Length:164 Species:Mus musculus


Alignment Length:163 Identity:96/163 - (58%)
Similarity:116/163 - (71%) Gaps:3/163 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VKEKPNSTRIYDKDGFRRRAACICVKSENEAEVLLVTSSRRPELWIVPGGGVEPEEESSVTAVRE 66
            :|.|||.||.||.:||::||||:|.:||.|.|||||:|||.|:.|||||||:|||||....||||
Mouse     1 MKCKPNQTRTYDPEGFKKRAACLCFRSEREDEVLLVSSSRYPDRWIVPGGGMEPEEEPDGAAVRE 65

  Fly    67 VLEEAGVVGDLGRCLGVFE-NNDHMHRTEVFVMNVTQELDEWEDSRSIGRKRQWFTIDDALSQLA 130
            |.|||||.|.|||.||||| |.|..|||.|||:.||:.|::||||.||||||:||.|:||:..|.
Mouse    66 VYEEAGVKGKLGRLLGVFEQNQDRKHRTYVFVLTVTELLEDWEDSVSIGRKREWFKIEDAIKVLQ 130

  Fly   131 LHKPTQQHYLMQLQHSKTLDNTNRVVNATHPPK 163
            .|||....||.:|:...:..|.|..  |..||:
Mouse   131 CHKPVHAEYLEKLKLGGSPTNGNSA--APSPPE 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ApsNP_648421.1 Nudix_Hydrolase_9 19..137 CDD:240024 78/118 (66%)
Nudt10NP_001026834.1 Substrate binding. /evidence=ECO:0000250|UniProtKB:O95989 17..19 0/1 (0%)
Nudix_Hydrolase_9 18..137 CDD:240024 78/118 (66%)
Substrate binding. /evidence=ECO:0000250|UniProtKB:O95989 38..40 1/1 (100%)
Nudix box 50..71 14/20 (70%)
Substrate binding. /evidence=ECO:0000250|UniProtKB:O95989 89..91 0/1 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 144..164 5/20 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 159 1.000 Domainoid score I4070
eggNOG 1 0.900 - - E1_COG0494
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 193 1.000 Inparanoid score I3835
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG58445
OrthoDB 1 1.010 - - D1324716at2759
OrthoFinder 1 1.000 - - FOG0000621
OrthoInspector 1 1.000 - - otm43498
orthoMCL 1 0.900 - - OOG6_101097
Panther 1 1.100 - - O PTHR12629
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R74
SonicParanoid 1 1.000 - - X795
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.870

Return to query results.
Submit another query.