DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aps and nudt6

DIOPT Version :9

Sequence 1:NP_648421.1 Gene:Aps / 39226 FlyBaseID:FBgn0036111 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_001082991.1 Gene:nudt6 / 100037370 ZFINID:ZDB-GENE-070410-44 Length:331 Species:Danio rerio


Alignment Length:124 Identity:30/124 - (24%)
Similarity:54/124 - (43%) Gaps:17/124 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 VKSENEAEVLLVTS-SRRPELWIVPGGGVEPEEESSVTAVREVLEEAGVVGDLGRCLGVFENNDH 89
            |..|:..:||:|.. ::....|..|||..:..|..:.||||||.||.||..:....|.:.:.:.|
Zfish   164 VLDESNGKVLVVQDRNKTKNAWKFPGGLSDLGENIADTAVREVFEETGVRSEFRSLLSLRQQHTH 228

  Fly    90 ---MHRTEVFVMNVTQELD-------------EWEDSRSIGRKRQWFTIDDALSQLALH 132
               ...::::::...|.|.             :|.|.|.:....:...|...:::|.|:
Zfish   229 PGAFGMSDLYLICRLQPLSHRIHICTHECLRCDWLDLRELAETSETTPITSRIAKLLLY 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ApsNP_648421.1 Nudix_Hydrolase_9 19..137 CDD:240024 30/124 (24%)
nudt6NP_001082991.1 Nudix_Hydrolase_12 156..289 CDD:240027 30/124 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.