DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr67Fb and Cpr76Ba

DIOPT Version :10

Sequence 1:NP_648420.1 Gene:Cpr67Fb / 39225 FlyBaseID:FBgn0036110 Length:122 Species:Drosophila melanogaster
Sequence 2:NP_649120.1 Gene:Cpr76Ba / 40120 FlyBaseID:FBgn0036878 Length:204 Species:Drosophila melanogaster


Alignment Length:81 Identity:25/81 - (30%)
Similarity:36/81 - (44%) Gaps:6/81 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 AADESQAETTKYRNEIKPDGSYSWEYG---TSNG-IDAQESGVGGVQAAGSVSYAAPDGTPIQLE 78
            ||.:|..:.: :..|.|....|.:.||   |..| |..|.....|.:..|..:....||....:|
  Fly    80 AAHDSHHQWS-HHEEPKHHPKYEFNYGVKDTKTGDIKQQWETRDGDKVKGGYTMKEADGRTRIVE 143

  Fly    79 YTAD-ENGYRPTGAHL 93
            |||| .||::.|..|:
  Fly   144 YTADSHNGFQATVKHV 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr67FbNP_648420.1 Chitin_bind_4 39..86 CDD:459790 17/51 (33%)
Cpr76BaNP_649120.1 Chitin_bind_4 100..152 CDD:459790 17/51 (33%)

Return to query results.
Submit another query.