DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr67Fb and Cpr65Ec

DIOPT Version :9

Sequence 1:NP_648420.1 Gene:Cpr67Fb / 39225 FlyBaseID:FBgn0036110 Length:122 Species:Drosophila melanogaster
Sequence 2:NP_648077.1 Gene:Cpr65Ec / 38775 FlyBaseID:FBgn0035737 Length:127 Species:Drosophila melanogaster


Alignment Length:112 Identity:64/112 - (57%)
Similarity:84/112 - (75%) Gaps:1/112 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LIISLFLVAAIRA-ADESQAETTKYRNEIKPDGSYSWEYGTSNGIDAQESGVGGVQAAGSVSYAA 69
            |.::...|:.::| :.:::|||.:|::::|.||||:::|.|||||..|||||||..|:||.:|.|
  Fly     7 LAVAALAVSCVQADSFDARAETREYKSDLKEDGSYAYQYQTSNGIAGQESGVGGYYASGSNAYYA 71

  Fly    70 PDGTPIQLEYTADENGYRPTGAHLPTPPPIPDYILKALAYIEAHPFQ 116
            |||..|||.||||.|||.|.|||||||||||..|||:|.||..||.|
  Fly    72 PDGQLIQLTYTADSNGYHPAGAHLPTPPPIPASILKSLEYIRTHPQQ 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr67FbNP_648420.1 Chitin_bind_4 39..86 CDD:278791 30/46 (65%)
Cpr65EcNP_648077.1 Chitin_bind_4 41..88 CDD:278791 30/46 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470136
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26179
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9674
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.