DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr67Fb and Cpr65Az

DIOPT Version :9

Sequence 1:NP_648420.1 Gene:Cpr67Fb / 39225 FlyBaseID:FBgn0036110 Length:122 Species:Drosophila melanogaster
Sequence 2:NP_648031.1 Gene:Cpr65Az / 38712 FlyBaseID:FBgn0035686 Length:239 Species:Drosophila melanogaster


Alignment Length:94 Identity:46/94 - (48%)
Similarity:59/94 - (62%) Gaps:9/94 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 KYRNEIKPDGSYSWEYGTSNGIDAQE------SGVGGVQ---AAGSVSYAAPDGTPIQLEYTADE 83
            |..:::..||||.:||.|.|||.|:|      :||.|.:   |.||.||.:|:|..|.|.|.|||
  Fly   118 KLESKVNTDGSYMYEYETGNGIKAEEMGYLKNAGVEGAEAQTAEGSFSYTSPEGQEISLTYIADE 182

  Fly    84 NGYRPTGAHLPTPPPIPDYILKALAYIEA 112
            ||::|.|.|||||||||..|.:||..:.|
  Fly   183 NGFQPQGDHLPTPPPIPIEIQEALDKLAA 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr67FbNP_648420.1 Chitin_bind_4 39..86 CDD:278791 26/55 (47%)
Cpr65AzNP_648031.1 Chitin_bind_4 129..185 CDD:278791 26/55 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439318
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.