DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr67Fb and Lcp65Aa

DIOPT Version :10

Sequence 1:NP_648420.1 Gene:Cpr67Fb / 39225 FlyBaseID:FBgn0036110 Length:122 Species:Drosophila melanogaster
Sequence 2:NP_477280.1 Gene:Lcp65Aa / 38709 FlyBaseID:FBgn0020645 Length:102 Species:Drosophila melanogaster


Alignment Length:101 Identity:33/101 - (32%)
Similarity:54/101 - (53%) Gaps:9/101 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 IKTALIISLFLVAAIRAADESQAETTKYRNEIKPDGSYSWEYGTSNGIDAQESG----VG----G 58
            :|:.|:::..|.|...||....||.....:::..| |||:::.||:|...::.|    :|    .
  Fly     1 MKSILVLACLLSALCLAAAAPDAEIVDLVSDVNAD-SYSYKFETSDGTKQEQHGSLKSLGPEEDA 64

  Fly    59 VQAAGSVSYAAPDGTPIQLEYTADENGYRPTGAHLP 94
            :|.|||.|:...||....:.|.|||||::|.|..:|
  Fly    65 LQVAGSFSFVGDDGQTHAISYVADENGFQPQGEDIP 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr67FbNP_648420.1 Chitin_bind_4 39..86 CDD:459790 19/54 (35%)
Lcp65AaNP_477280.1 Chitin_bind_4 37..92 CDD:459790 19/54 (35%)

Return to query results.
Submit another query.