DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr67Fb and Cpr47Ec

DIOPT Version :10

Sequence 1:NP_648420.1 Gene:Cpr67Fb / 39225 FlyBaseID:FBgn0036110 Length:122 Species:Drosophila melanogaster
Sequence 2:NP_610657.1 Gene:Cpr47Ec / 36191 FlyBaseID:FBgn0033600 Length:131 Species:Drosophila melanogaster


Alignment Length:100 Identity:26/100 - (26%)
Similarity:45/100 - (45%) Gaps:15/100 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IISLFLVAAIRA------ADESQAETTKYRNE-IKPDGSYSWEYGTSNGIDAQESGV-------- 56
            |:.||::|.:.|      .|..:......::| ||.:..|:..|..::||...|...        
  Fly     4 ILPLFVLAVMVACGQALPVDPEREPVAILKSEIIKTEEGYTSAYVGADGISRNEEAFLVDKGTDE 68

  Fly    57 GGVQAAGSVSYAAPDGTPIQLEYTADENGYRPTGA 91
            ..::..||..|...||..:::.|||.:||:.|.|:
  Fly    69 EALEVKGSYKYINEDGQEVEVFYTAGKNGFVPYGS 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr67FbNP_648420.1 Chitin_bind_4 39..86 CDD:459790 14/54 (26%)
Cpr47EcNP_610657.1 Chitin_bind_4 43..98 CDD:459790 14/54 (26%)

Return to query results.
Submit another query.