DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr67Fb and Cpr12A

DIOPT Version :9

Sequence 1:NP_648420.1 Gene:Cpr67Fb / 39225 FlyBaseID:FBgn0036110 Length:122 Species:Drosophila melanogaster
Sequence 2:NP_572896.1 Gene:Cpr12A / 32309 FlyBaseID:FBgn0030494 Length:173 Species:Drosophila melanogaster


Alignment Length:108 Identity:28/108 - (25%)
Similarity:47/108 - (43%) Gaps:15/108 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ALIISLFLVAA-------IRAADESQAETTKYRNEIKPDGSYSWEYGTSNGIDAQESG------- 55
            :::.::||::|       |:.:..|.....::.|.. |||||.:.:...:|....|.|       
  Fly     6 SILFAIFLLSATLISAQQIKESAPSARLLDRFDNRY-PDGSYEYRFELDDGTARYERGYFVKIND 69

  Fly    56 VGGVQAAGSVSYAAPDGTPIQLEYTADENGYRPTGAHLPTPPP 98
            |..:...|..:|...||..|.:.|.||:.|||...:..|...|
  Fly    70 VKTLMVVGYYAYRMTDGRYITVFYNADQFGYRQNQSITPQEYP 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr67FbNP_648420.1 Chitin_bind_4 39..86 CDD:278791 13/53 (25%)
Cpr12ANP_572896.1 Chitin_bind_4 46..100 CDD:278791 13/53 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439178
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.