DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr67Fa2 and Cpr65Au

DIOPT Version :10

Sequence 1:NP_648419.1 Gene:Cpr67Fa2 / 39224 FlyBaseID:FBgn0036109 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_652661.1 Gene:Cpr65Au / 59158 FlyBaseID:FBgn0042119 Length:106 Species:Drosophila melanogaster


Alignment Length:105 Identity:34/105 - (32%)
Similarity:54/105 - (51%) Gaps:14/105 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 FRYMLVASAVLAC-AYGAATYNQEAGAYITKIGSDIQPEGNYNYQYETSNGIAAQESG------- 58
            |.:::...|:..| |:.|   .::|.|...|:.|: .....|::.|||||||:..|:|       
  Fly     5 FMWLVAFLAIGICLAFPA---GEDAQAETIKLESE-NTGDKYSFAYETSNGISRTETGEVKPGAG 65

  Fly    59 --IGGNHANGGFSWYSPEGELVQISYVADENGYQPQGALL 96
              .|.....|..||.:|:|:..:||:.|||.||.|:..|:
  Fly    66 EEDGSLSVQGSTSWSAPDGKKYEISFTADETGYHPKFRLV 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr67Fa2NP_648419.1 Chitin_bind_4 42..89 CDD:459790 21/55 (38%)
Cpr65AuNP_652661.1 Chitin_bind_4 42..98 CDD:459790 21/55 (38%)

Return to query results.
Submit another query.