DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr67Fa2 and Lcp65Af

DIOPT Version :9

Sequence 1:NP_648419.1 Gene:Cpr67Fa2 / 39224 FlyBaseID:FBgn0036109 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_477274.1 Gene:Lcp65Af / 45017 FlyBaseID:FBgn0020639 Length:100 Species:Drosophila melanogaster


Alignment Length:108 Identity:40/108 - (37%)
Similarity:61/108 - (56%) Gaps:17/108 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RYMLVASAVLACAYGAATYNQEAGAYITKIGSDIQPEGNYNYQYETSNGIAAQESG----IGGN- 62
            ::::|..|:.|.|.        |...|.|..||:.|. ::||.||||:|.:||.:|    :|.: 
  Fly     2 KFLIVFVALFALAV--------ADVQILKQESDVGPV-SFNYGYETSDGSSAQAAGQLKNVGTDE 57

  Fly    63 ---HANGGFSWYSPEGELVQISYVADENGYQPQGALLPTPPPI 102
               :..|.:|:.:.:|:...|:|.|||||||||||.||..|.:
  Fly    58 EALNVKGTYSFVADDGQTYSIAYTADENGYQPQGAHLPVAPVV 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr67Fa2NP_648419.1 Chitin_bind_4 42..89 CDD:278791 20/54 (37%)
Lcp65AfNP_477274.1 Chitin_bind_4 32..87 CDD:278791 20/54 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.