DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr67Fa2 and Cpr78E

DIOPT Version :9

Sequence 1:NP_648419.1 Gene:Cpr67Fa2 / 39224 FlyBaseID:FBgn0036109 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_649345.1 Gene:Cpr78E / 40408 FlyBaseID:FBgn0037114 Length:137 Species:Drosophila melanogaster


Alignment Length:140 Identity:31/140 - (22%)
Similarity:63/140 - (45%) Gaps:19/140 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFRYMLVA-----SAVLACAYGAATYNQEAGAYITKIGSDIQPEGNYNYQYETSNGIAAQESGIG 60
            ||:.::||     :.||:......|...:....|.:...:...:|:||:.|...:|...:|..:.
  Fly     1 MFKILIVALSLCTAVVLSAPVDHVTSTTQPPVAILESSHEKHEDGSYNFSYLGEDGTHRREEAVV 65

  Fly    61 GNHA--------NGGFSWYSPEGELVQISYVADENGYQPQGALLPTPPPIPAAILRSLEYIRTHP 117
            .|..        :|.:|::...|:.|.::|.||::|:.|:|..:     :|...|.:.:.....|
  Fly    66 RNQGTENEYLEISGSYSYFDANGQEVTVTYKADDHGFVPEGGAI-----LPQISLAAKQVSEQVP 125

  Fly   118 QYVEQEYRRP 127
            | .:.:|.:|
  Fly   126 Q-PDLDYAKP 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr67Fa2NP_648419.1 Chitin_bind_4 42..89 CDD:278791 13/54 (24%)
Cpr78ENP_649345.1 Chitin_bind_4 47..102 CDD:278791 13/54 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.