DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr67Fa2 and Cpr65Ea

DIOPT Version :9

Sequence 1:NP_648419.1 Gene:Cpr67Fa2 / 39224 FlyBaseID:FBgn0036109 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_648075.1 Gene:Cpr65Ea / 38773 FlyBaseID:FBgn0035735 Length:127 Species:Drosophila melanogaster


Alignment Length:117 Identity:54/117 - (46%)
Similarity:74/117 - (63%) Gaps:5/117 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFRYMLVASAVLACAYGAATYNQEAGAYITKIGSDIQPEGNYNYQYETSNGIAAQESGIGGNHAN 65
            |::.:||. |:..||. ||..|.:.   |||..::...:|.|.|..|.::||..:|.|:.|:.|:
  Fly     1 MYKLLLVV-ALFGCAL-AAPLNDDT---ITKFLANQDTDGTYAYDIEQASGIQIKEEGLAGHEAH 60

  Fly    66 GGFSWYSPEGELVQISYVADENGYQPQGALLPTPPPIPAAILRSLEYIRTHP 117
            |.:|:.||||..||:.|.|||.|:.||..|||||||||..||||:.||:.||
  Fly    61 GSYSYISPEGIPVQVVYTADEFGFHPQSNLLPTPPPIPEEILRSIRYIQEHP 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr67Fa2NP_648419.1 Chitin_bind_4 42..89 CDD:278791 21/46 (46%)
Cpr65EaNP_648075.1 Chitin_bind_4 37..84 CDD:306811 21/46 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439263
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.