DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr67Fa2 and Cpr49Ah

DIOPT Version :9

Sequence 1:NP_648419.1 Gene:Cpr67Fa2 / 39224 FlyBaseID:FBgn0036109 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_610777.1 Gene:Cpr49Ah / 36354 FlyBaseID:FBgn0033731 Length:190 Species:Drosophila melanogaster


Alignment Length:125 Identity:42/125 - (33%)
Similarity:60/125 - (48%) Gaps:25/125 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 ITKIGSDIQPEGNYNYQYETSNGIAAQESGI---------GGNHANGGFSWYSPEGELVQISYVA 84
            |.|...:...:|:|..:|||.|.|..:|:|.         |....:|.:|:.||||.||.:.|.|
  Fly    53 IIKYNKEQSDDGSYKTEYETGNSIIHEETGFLKDFDTNPNGVLVQHGQYSYQSPEGTLVNVQYTA 117

  Fly    85 DENGYQPQGALLPTPPPIPAAILRSLEYI---------------RTHPQYVEQ-EYRRPA 128
            ||||::..|..:||||.||..|.:.|:.|               :|.|.:..: |.||.|
  Fly   118 DENGFRATGDHIPTPPAIPEEIQKGLDQIYAGIKLQQERLEQRAKTDPDFARKLEERRVA 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr67Fa2NP_648419.1 Chitin_bind_4 42..89 CDD:278791 22/55 (40%)
Cpr49AhNP_610777.1 Chitin_bind_4 66..122 CDD:395303 22/55 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.