DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr67Fa2 and Cpr49Ab

DIOPT Version :9

Sequence 1:NP_648419.1 Gene:Cpr67Fa2 / 39224 FlyBaseID:FBgn0036109 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_610769.1 Gene:Cpr49Ab / 36345 FlyBaseID:FBgn0050042 Length:259 Species:Drosophila melanogaster


Alignment Length:107 Identity:36/107 - (33%)
Similarity:56/107 - (52%) Gaps:8/107 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 GAATYNQEAGAYITKIGSDIQPEGNYNYQYETSNGIAAQESG-------IGGNHANGGFSWYSPE 74
            |..|.....|..|.:...|::.:| |:|.:||.|||..:|||       ..|..:.|.:.:..|:
  Fly   149 GRGTGEGGNGWAIIRQEDDVEVDG-YHYLWETENGILGEESGRIEKLTEEEGLRSKGFYEYTGPD 212

  Fly    75 GELVQISYVADENGYQPQGALLPTPPPIPAAILRSLEYIRTH 116
            |.|.::.||||:||:.|..|.|||.||.|..:.:.|.::..:
  Fly   213 GILYRVDYVADDNGFVPSAAHLPTAPPPPPYVEKLLAFLEAN 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr67Fa2NP_648419.1 Chitin_bind_4 42..89 CDD:278791 20/53 (38%)
Cpr49AbNP_610769.1 Chitin_bind_4 173..227 CDD:278791 20/53 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439133
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.