DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr67Fa2 and Cpr47Ea

DIOPT Version :9

Sequence 1:NP_648419.1 Gene:Cpr67Fa2 / 39224 FlyBaseID:FBgn0036109 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_610654.1 Gene:Cpr47Ea / 36188 FlyBaseID:FBgn0033597 Length:135 Species:Drosophila melanogaster


Alignment Length:90 Identity:41/90 - (45%)
Similarity:56/90 - (62%) Gaps:8/90 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 EAGAYITKIGSDIQPEGNYNYQYETSNGIAAQESG--------IGGNHANGGFSWYSPEGELVQI 80
            :|.|.|.|...|:.|:|:|.|.|||||||.|.|:|        |......|.:|:..|:|.:..|
  Fly    38 DANAVILKQNFDLNPDGSYQYNYETSNGIRADEAGYLKNPGSQIEAQVMQGSYSYTGPDGVVYTI 102

  Fly    81 SYVADENGYQPQGALLPTPPPIPAA 105
            :|:||||||:.:||.:|||||:.||
  Fly   103 TYIADENGYRAEGAHIPTPPPVRAA 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr67Fa2NP_648419.1 Chitin_bind_4 42..89 CDD:278791 23/54 (43%)
Cpr47EaNP_610654.1 Chitin_bind_4 56..111 CDD:278791 23/54 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439193
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.