DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr67Fa1 and Cpr76Ba

DIOPT Version :10

Sequence 1:NP_648418.1 Gene:Cpr67Fa1 / 39223 FlyBaseID:FBgn0036108 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_649120.1 Gene:Cpr76Ba / 40120 FlyBaseID:FBgn0036878 Length:204 Species:Drosophila melanogaster


Alignment Length:56 Identity:17/56 - (30%)
Similarity:26/56 - (46%) Gaps:3/56 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 PEGNYNYQY-ETSNG-IAAQESGIGGNHANGGFSWYSPEGELVQISYVAD-ENGYQ 90
            |:..:||.. :|..| |..|.....|:...||::....:|....:.|.|| .||:|
  Fly    98 PKYEFNYGVKDTKTGDIKQQWETRDGDKVKGGYTMKEADGRTRIVEYTADSHNGFQ 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr67Fa1NP_648418.1 Chitin_bind_4 42..89 CDD:459790 14/49 (29%)
Cpr76BaNP_649120.1 Chitin_bind_4 100..152 CDD:459790 14/51 (27%)

Return to query results.
Submit another query.