DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr67Fa1 and Cpr64Ac

DIOPT Version :10

Sequence 1:NP_648418.1 Gene:Cpr67Fa1 / 39223 FlyBaseID:FBgn0036108 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_647874.1 Gene:Cpr64Ac / 38510 FlyBaseID:FBgn0035512 Length:188 Species:Drosophila melanogaster


Alignment Length:108 Identity:26/108 - (24%)
Similarity:44/108 - (40%) Gaps:24/108 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LLVASAI-----LACAYGAATYNQEAGAYITK------------IGSDIQPEGNYNYQY-----E 47
            ||.|.||     ...|..|.:|...|.:|..|            :.....|...|::.|     .
  Fly    38 LLAAPAISYAAPKLLAAPAISYAAPAISYAPKVLAAPVAVAKVAVAEPYDPNPQYSFSYGVTDHH 102

  Fly    48 TSNGIAAQESGIGGNHANGGFSWYSPEGELVQISYVADE-NGY 89
            |.:....:|:.:.| ..:|.:|...|:|.:.:::|.||: ||:
  Fly   103 TGDSKQQEETLVNG-VVHGSYSLAEPDGTIRKVTYTADKVNGF 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr67Fa1NP_648418.1 Chitin_bind_4 42..89 CDD:459790 13/52 (25%)
Cpr64AcNP_647874.1 Chitin_bind_4 92..144 CDD:459790 13/52 (25%)

Return to query results.
Submit another query.