DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr67Fa1 and Cpr47Ee

DIOPT Version :9

Sequence 1:NP_648418.1 Gene:Cpr67Fa1 / 39223 FlyBaseID:FBgn0036108 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_610659.1 Gene:Cpr47Ee / 36193 FlyBaseID:FBgn0033602 Length:369 Species:Drosophila melanogaster


Alignment Length:147 Identity:35/147 - (23%)
Similarity:59/147 - (40%) Gaps:48/147 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 YNQEAGAYITKIGSDIQPEGNYNYQYETSNGIAAQE----------SGIGGNHANGGFSWYSPEG 75
            |.|:....||...:::..:|:::|.|.:::|..||.          .|:......|.:|:.||||
  Fly    99 YQQQNYVPITAYQNELNLDGSFSYGYSSADGTTAQAQGYVKNLGYGEGVEAQVIQGSYSYTSPEG 163

  Fly    76 ELVQISYVADENGYQPQGALLPT------------------------------PPPIPAAILRSL 110
            ..:.:.|:|||||::.:|..:|:                              |||:|.|..|  
  Fly   164 TPITVRYIADENGFRAEGTGIPSSPQYFAGAQPYQQGLLNPNLNPYQTPFRQLPPPLPNAPFR-- 226

  Fly   111 EYIRTHPQYVEQEYRRP 127
                  ||...|:...|
  Fly   227 ------PQLPGQQPLTP 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr67Fa1NP_648418.1 Chitin_bind_4 42..89 CDD:278791 17/56 (30%)
Cpr47EeNP_610659.1 Chitin_bind_4 120..177 CDD:278791 17/56 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.