DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr67Fa1 and Pcp

DIOPT Version :9

Sequence 1:NP_648418.1 Gene:Cpr67Fa1 / 39223 FlyBaseID:FBgn0036108 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_476673.1 Gene:Pcp / 33985 FlyBaseID:FBgn0003046 Length:184 Species:Drosophila melanogaster


Alignment Length:127 Identity:59/127 - (46%)
Similarity:79/127 - (62%) Gaps:10/127 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YLL----VASAILACAYGAATYNQEAGAYITKIGSDIQPE--GNYNYQYETSNGIAAQESGIGGN 62
            |||    ||.|:|....| ::|..::......:.:|:|.|  |.|.|.|||||||:|.:.|:||.
  Fly     2 YLLVNFIVALAVLQVQAG-SSYIPDSDRNTRTLQNDLQVERDGKYRYAYETSNGISASQEGLGGV 65

  Fly    63 HANGGFSWYSPEGELVQISYVADENGYQPQGALLPTPPPIPAAILRSLEYIRTHPQYVEQEY 124
            ...||.|:.|||||::.::|||||.||.|.||.:   |.:|..||||||||||||..::..|
  Fly    66 AVQGGSSYTSPEGEVISVNYVADEFGYHPVGAHI---PQVPDYILRSLEYIRTHPYQIKDYY 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr67Fa1NP_648418.1 Chitin_bind_4 42..89 CDD:278791 26/46 (57%)
PcpNP_476673.1 Chitin_bind_4 45..92 CDD:278791 26/46 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470149
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.