DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OXA1L and AT1G44890

DIOPT Version :9

Sequence 1:NP_648417.1 Gene:OXA1L / 39222 FlyBaseID:FBgn0027615 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_175111.3 Gene:AT1G44890 / 841055 AraportID:AT1G44890 Length:281 Species:Arabidopsis thaliana


Alignment Length:102 Identity:26/102 - (25%)
Similarity:44/102 - (43%) Gaps:18/102 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 WWGTIAIGTLAVRTIIFPLVILAQRNSAKMNNNMPQMQMLQLKMTEARQSGNAIESARY---AQE 213
            ||..|.:.:|.:|.|..|:::....|.||...::...|            |..::...:   ::.
plant   132 WWVFIIVASLLIRGITVPVMVDMLNNIAKFFKSLRSNQ------------GEVLDKVSFLNKSRG 184

  Fly   214 MMLFMREKGVNPLKNMVVPLA-QAPLFISFFMG-LRQ 248
            :|..|.||....:|..|:... |.|:| .|.|| |:|
plant   185 VMYTMLEKEFFGVKGSVIGQGIQVPIF-WFSMGELKQ 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OXA1LNP_648417.1 yidC_oxa1_cterm 152..342 CDD:274665 26/102 (25%)
AT1G44890NP_175111.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001122
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12428
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.