DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OXA1L and AT3G44370

DIOPT Version :9

Sequence 1:NP_648417.1 Gene:OXA1L / 39222 FlyBaseID:FBgn0027615 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_190023.2 Gene:AT3G44370 / 823562 AraportID:AT3G44370 Length:566 Species:Arabidopsis thaliana


Alignment Length:399 Identity:86/399 - (21%)
Similarity:151/399 - (37%) Gaps:84/399 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 TELVDLPDIPAAPVPPPADGLNVMDVMNAAGE--------PSFASIGLGGWSPVGM--------- 136
            :||....|...|.|.....||...|.:.:.|.        .|..|:|..|:   |:         
plant    52 SELTRFRDDSIAGVGSNDHGLEFDDSIASLGSNGHGLEFGDSIGSLGSNGY---GLEFGDLSQDL 113

  Fly   137 ---------VQNCLEFLHCTWDIPWWGTIAIGTLAVRTIIFPLVILAQRNSAKMNNNMPQMQMLQ 192
                     |.:.|:..|....:|||..||..|:|.||.:.|::||.::.:.:::..:|::.   
plant   114 SNYDYLTQPVISLLDSYHDITGLPWWVVIATSTVAFRTALLPILILQRKQTKRISQFLPKLP--- 175

  Fly   193 LKMTEARQSGNAIESARYAQEMMLFMRE-KGVNPLKNMVVPL---AQAPLFISFFMGLRQMANAP 253
             .....:.||.::     ..::.||.:| |.:.....:.||.   .|...|..:...:|:|:...
plant   176 -HFWPPQGSGRSV-----LDQLKLFRKERKDIGCPSFLWVPAYFSIQISCFFLWITSIRRMSLDH 234

  Fly   254 VESMRDGGLFWFTDLT-MADPFY--LLPLITSATLYLTIEIGTDSARLSAANMNT-----MKYVL 310
            ......||..||.:|| :.:..|  |.|.:.:...|...:|...::.:...:..|     .|..|
plant   235 HPGFDSGGALWFQNLTEIPNGLYGPLFPFLIAGLHYTNTQITFTASSVHKVDKFTELAKAYKTFL 299

  Fly   311 RALPIVIFPFTMNFPAAILTYWACSNFISLGQVAVLRIPSVREYFKIEKMLTHAPSALPPKKGFV 375
            ..|...::..:...|...|.|||.:...|:.|.::|..|.|.     .|:...|..::..:.|  
plant   300 NLLTCALYFLSFQMPQGSLLYWATNLSFSIAQQSILNHPVVS-----AKLGLQANDSVQKEAG-- 357

  Fly   376 GGMKESWDNMKISKEIEERQRLDEIRFAKAGKGPLVKTYKFDPTKV----AKPIS------AEPH 430
                     ..|...|.|.:..|     .:.||.|:..:...|.::    ||.:|      :.|.
plant   358 ---------NPILTNINEGKLTD-----PSSKGRLISVHNLTPKELVALSAKYLSGGHKDKSIPL 408

  Fly   431 MRL---KEP 436
            :||   |:|
plant   409 LRLALEKDP 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OXA1LNP_648417.1 yidC_oxa1_cterm 152..342 CDD:274665 45/201 (22%)
AT3G44370NP_190023.2 60KD_IMP 77..356 CDD:294333 61/295 (21%)
TPR_11 386..446 CDD:290150 9/32 (28%)
TPR repeat 386..414 CDD:276809 7/27 (26%)
TPR repeat 419..453 CDD:276809
TPR repeat 458..491 CDD:276809
TPR repeat 500..535 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0706
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1314061at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12428
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.