DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OXA1L and AT2G46455

DIOPT Version :9

Sequence 1:NP_648417.1 Gene:OXA1L / 39222 FlyBaseID:FBgn0027615 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_001324489.1 Gene:AT2G46455 / 819254 AraportID:AT2G46455 Length:200 Species:Arabidopsis thaliana


Alignment Length:86 Identity:19/86 - (22%)
Similarity:37/86 - (43%) Gaps:6/86 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 NVMD------VMNAAGEPSFASIGLGGWSPVGMVQNCLEFLHCTWDIPWWGTIAIGTLAVRTIIF 168
            ||::      |.|.|......:|....:||.|.||..:..:|......||.:|.:....|..::.
plant    94 NVVEESVEAIVTNVATIDECTAITESVFSPEGFVQYVINGIHELTGFNWWMSIVLTAFLVTVLMS 158

  Fly   169 PLVILAQRNSAKMNNNMPQMQ 189
            |:.:..|..:.::.:.:..|:
plant   159 PVSMRVQNLALELQSLIRSME 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OXA1LNP_648417.1 yidC_oxa1_cterm 152..342 CDD:274665 7/38 (18%)
AT2G46455NP_001324489.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0706
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1314061at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.