DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OXA1L and CG4942

DIOPT Version :9

Sequence 1:NP_648417.1 Gene:OXA1L / 39222 FlyBaseID:FBgn0027615 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_648286.1 Gene:CG4942 / 39044 FlyBaseID:FBgn0035960 Length:351 Species:Drosophila melanogaster


Alignment Length:316 Identity:81/316 - (25%)
Similarity:130/316 - (41%) Gaps:50/316 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 AAGEPSFASIG--LGGW------SPVGMVQNCLEFLHCTWDIPWWGTIAIGTLAVRTII-FPLVI 172
            ||.....|:.|  :|.|      :||..:|:.|..:|....:|||.:|.:.|...|::: .||.|
  Fly    43 AAASVQLANAGGLVGYWQTLSNSTPVAYMQDVLIKIHDYSGLPWWASIVLSTFLFRSVVTLPLTI 107

  Fly   173 LAQRNSAKMNNNMPQMQML--QLKMTEA----------RQSGNAIESARYAQEMMLFMREKGVNP 225
            ...:.:|::.....:|..:  :||...|          :|:......:...|...|.:|: ..:|
  Fly   108 YQHKITARIEKIALEMPAIVEELKKEAAMAKHKFKWSEKQTQIVYRRSIKKQWQNLIVRD-NCHP 171

  Fly   226 LKNMVVPLAQAPLFISFFMGLRQM-----------ANAPVESMRDGGLFWFTDLTMADPFYLLPL 279
            :|.|:|...|.||:|...:.||.:           |......|..||..|..:||:.|..|:||:
  Fly   172 MKTMIVLWGQIPLWIFQSVALRNLVYMLPDPTSIQAQIVTTEMTIGGFGWIPNLTVVDNSYILPV 236

  Fly   280 ITSATLYLTIEIGTDS-ARLSAANMNTMKYVLRALPIVIFPFTMNFPAAILTYWACSNFISLGQV 343
            .........||:...| .|.|....|....|.|.|.:|:.|.....|:|:..||..|:...|.|.
  Fly   237 ALGLINLAIIEVQAMSRTRPSTRLQNIANNVFRGLSVVMVPVACTVPSALCVYWVASSSFGLAQN 301

  Fly   344 AVLRIPSVREYFKIEKMLTHAPSALPPKKGFVGGMKESWDNMKISKEIEERQRLDE 399
            .::..|.||....|.|..|.              :.|.:|.:.:  :|::|.||.|
  Fly   302 LLILSPEVRRSVGIPKTQTE--------------LSEPYDLLWL--KIQQRLRLAE 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OXA1LNP_648417.1 yidC_oxa1_cterm 152..342 CDD:274665 55/214 (26%)
CG4942NP_648286.1 60KD_IMP <67..311 CDD:294333 64/244 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449137
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0706
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D495015at33208
OrthoFinder 1 1.000 - - FOG0001122
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12428
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R242
SonicParanoid 00.000 Not matched by this tool.
76.880

Return to query results.
Submit another query.