DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OXA1L and Cox18

DIOPT Version :9

Sequence 1:NP_648417.1 Gene:OXA1L / 39222 FlyBaseID:FBgn0027615 Length:441 Species:Drosophila melanogaster
Sequence 2:XP_006250833.1 Gene:Cox18 / 289522 RGDID:1559547 Length:332 Species:Rattus norvegicus


Alignment Length:326 Identity:79/326 - (24%)
Similarity:133/326 - (40%) Gaps:77/326 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 AVPKTELVDLPDIP---AAPVPPPADGLNVMDVMNAAGEPSFASIGLGGW-------SPVGMVQN 139
            ::|......||.:|   ||.|              :|..|       |||       :||...:.
  Rat    23 SLPAWSSARLPTLPVWAAASV--------------SAASP-------GGWYEALAASAPVHAAEE 66

  Fly   140 CLEFLHCTWDIPWWGTIAIGTLAVR-TIIFPLVILAQRNSAKMNNNMPQMQMLQLKMTE-----A 198
            .|.....|..:||||.|.:.|:.:| .:..||........||:.|..|:::.:..::.:     |
  Rat    67 MLLSAQETTGLPWWGNILLSTVVLRGAVTLPLAAYQHYILAKVENLQPEIKDIAKRLNQEVAVCA 131

  Fly   199 RQSGNAIESAR--YAQEMM-----LFMREKGVNPLKNMVVPLAQAPLFISFFMGLRQMANAPVES 256
            ||.|.:...||  |.:.:.     |::|: ..:|.|..|:...|.|:::...:.||.::.....|
  Rat   132 RQFGWSKRVARLTYLKNIRRLVSELYVRD-NCHPFKATVLVWVQLPMWVFISVALRNLSTGATHS 195

  Fly   257 ---------MRDGGLFWFTDLTMADPFYLLPLITSATLYLTIE------IGTDSARLSAANMNTM 306
                     :..||..||.|||..|..::||:.......|.:|      ||....::...|.   
  Rat   196 DAGISVQDQLAAGGTLWFPDLTAVDSTWILPVSVGVVNLLIVEIFALQKIGKSRFQMYVTNF--- 257

  Fly   307 KYVLRALPIVIFPFTMNFPAAILTYWACSNFISLGQVAVLRIPSVREYFKIEKMLTHAPSALPPK 371
               :||:.:::.|.....|:|::.||.||:.:.|.|..:||.|..|:..:|           ||.
  Rat   258 ---VRAVSVLMVPVAATVPSALVLYWLCSSLMGLSQNLLLRSPGFRQLCRI-----------PPS 308

  Fly   372 K 372
            :
  Rat   309 R 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OXA1LNP_648417.1 yidC_oxa1_cterm 152..342 CDD:274665 54/217 (25%)
Cox18XP_006250833.1 5TM_Oxa1-like 76..297 CDD:410993 58/227 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0706
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D495015at33208
OrthoFinder 1 1.000 - - FOG0001122
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.