DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OXA1L and COX18

DIOPT Version :9

Sequence 1:NP_648417.1 Gene:OXA1L / 39222 FlyBaseID:FBgn0027615 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_001287658.1 Gene:COX18 / 285521 HGNCID:26801 Length:336 Species:Homo sapiens


Alignment Length:339 Identity:74/339 - (21%)
Similarity:118/339 - (34%) Gaps:106/339 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 GVSATKGEEFMQAVPKTELVDLPDIPAAPVPPPADGLNVMDVMNAAGE---PSFASIGL------ 128
            |:...:...|::|.           |:||:.........:..|..||.   |.....||      
Human    56 GLGTCRLRRFLRAA-----------PSAPLSQCGQWHQSLQYMRTAGTRPWPRLRRCGLRRKYCS 109

  Fly   129 ---------GG-------WSPVGMVQNCLEFLHCTWDIPWWGTIAIGTLAVRTIIFPLVILAQRN 177
                     ||       | |.|::..||          |..|                      
Human   110 ACTPPRACPGGAAFCSPPW-PYGVLSRCL----------WQPT---------------------- 141

  Fly   178 SAKMNNNMPQMQMLQLKMTEARQSGNAIESARYAQEMMLFMREKGVNPLKNMVVPLAQAPLFISF 242
               ...:.|::..|:             ...|...|  |::|: ..:|.|..|:...|.|::|..
Human   142 ---STTSWPRLTYLK-------------NMRRLISE--LYVRD-NCHPFKATVLVWIQLPMWIFM 187

  Fly   243 FMGLRQMANAPV--------ESMRDGGLFWFTDLTMADPFYLLPLITSATLYLTIEIGTDSARLS 299
            ...||.::....        |.:..||:.||.|||..|..::||:.......|.:||    ..|.
Human   188 SFALRNLSTGAAHSEGFSVQEQLATGGILWFPDLTAPDSTWILPISVGVINLLIVEI----CALQ 248

  Fly   300 AANMNTMK----YVLRALPIVIFPFTMNFPAAILTYWACSNFISLGQVAVLRIPSVREYFKIEKM 360
            ...|:..:    |.:||:.:::.|.....|::|:.||.||:|:.|.|..:||.|..|:..:|.. 
Human   249 KIGMSRFQTYITYFVRAMSVLMIPIAATVPSSIVLYWLCSSFVGLSQNLLLRSPGFRQLCRIPS- 312

  Fly   361 LTHAPSALPPKKGF 374
             |.:.|..|.|..|
Human   313 -TKSDSETPYKDIF 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OXA1LNP_648417.1 yidC_oxa1_cterm 152..342 CDD:274665 44/201 (22%)
COX18NP_001287658.1 60KD_IMP <153..302 CDD:294333 43/168 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0706
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1314061at2759
OrthoFinder 1 1.000 - - FOG0001122
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R242
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.