DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OXA1L and cox18

DIOPT Version :9

Sequence 1:NP_648417.1 Gene:OXA1L / 39222 FlyBaseID:FBgn0027615 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_588329.1 Gene:cox18 / 2539132 PomBaseID:SPCC1442.15c Length:202 Species:Schizosaccharomyces pombe


Alignment Length:211 Identity:61/211 - (28%)
Similarity:89/211 - (42%) Gaps:36/211 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 IPWWGTIAIGTLAVR-TIIFPLVILAQRNSAKMNNNMPQMQMLQLKMTEARQSGNAIESARYAQE 213
            :||...|....:.:| ||..|:.|.    |.|......|:|.|   :.||::........|..::
pombe    12 MPWCYEIPAMAIFLRSTITLPIAIA----SLKTARRFVQVQPL---IKEAKKRCRTNTDFRTVRK 69

  Fly   214 MMLFMREKGVNPLKNMVVPLAQAPLFISFFMGLRQMANAPVESMRDGGLFWFTDLTMADPFYLLP 278
            .:  .:....:||....:|:.|.|||......|||..:...|||...|:.||||||:.||..:||
pombe    70 KL--YKRFNCHPLMIYALPITQLPLFAFASYQLRQAVDVCPESMSTEGMLWFTDLTLPDPHGVLP 132

  Fly   279 LITSATLYLTIEIGTDSARLSAANMNTMKYVLRALPIVIF-------PFTMNFPA-----AILTY 331
            .:.:.| |||             ||:.:|....:..:.||       .|.::|.|     |:..|
pombe   133 AVLAVT-YLT-------------NMSILKRPSDSRLLKIFNTAGIMSAFFVSFMAFKTSTALSLY 183

  Fly   332 WACSNFISLGQVAVLR 347
            |..|...||.|...||
pombe   184 WTTSAIYSLVQNVALR 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OXA1LNP_648417.1 yidC_oxa1_cterm 152..342 CDD:274665 57/202 (28%)
cox18NP_588329.1 60KD_IMP <1..202 CDD:294333 61/211 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0706
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001122
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R242
SonicParanoid 1 1.000 - - X1877
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.