DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OXA1L and cox-18

DIOPT Version :9

Sequence 1:NP_648417.1 Gene:OXA1L / 39222 FlyBaseID:FBgn0027615 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_500037.2 Gene:cox-18 / 176930 WormBaseID:WBGene00021932 Length:317 Species:Caenorhabditis elegans


Alignment Length:259 Identity:58/259 - (22%)
Similarity:100/259 - (38%) Gaps:34/259 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 VQNCLEFLHCTWDIPWWGTIAIGTLAVRTIIFPLVILAQR---NSAKMNNNMPQMQMLQLKMTEA 198
            :|..:|.|| ...:.|.|......:.:|....||.|.|::   |.....|.:.|..|.::.....
 Worm    57 IQFGMESLH-GLGLSWPGAFISAAILLRIGTAPLHIYAEKLFANRLHAQNFLTQGIMKKVSERYR 120

  Fly   199 RQSGNAIESARY----------------AQEMMLFMREKGVNPLKNMVVPLAQAPLFISFFMGLR 247
            .|.|.:.:..:.                .||:...:.|.|:...:...:.:...|::|.....||
 Worm   121 VQLGPSTDGTKLEVKSSDPKIAKATQDALQEVPAMLAEHGLQAARIQNLKMCTVPVWIFSSFALR 185

  Fly   248 QMANAPVESMRDGGLFWFTDLTMADPFYLLPLITSATLYLTIEIGTDSARLSAANMNTMKYVLRA 312
            .:.|:.......|.| |..|:...||:::||:......:|.:.    |.|.....:..|.:..::
 Worm   186 NVINSDFHPSVAGHL-WIPDMLAPDPYFILPVAVGVFGFLNLY----SQRKIYPGVVKMTWKQKS 245

  Fly   313 LPIVIFPFTM-------NFPAAILTYWACSNFISLGQVAVLRIPSVREYFKIEKMLTHAPSALP 369
            ...|:..|||       ..||.|..||...:...:.|..:||.|.::..|.|:|:.|  .||.|
 Worm   246 YDGVLAFFTMFAVTIMAQLPACIPLYWLIVSTTGMAQAQMLRHPKIKGIFGIKKLPT--DSATP 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OXA1LNP_648417.1 yidC_oxa1_cterm 152..342 CDD:274665 43/215 (20%)
cox-18NP_500037.2 60KD_IMP <182..282 CDD:294333 24/104 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0706
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D495015at33208
OrthoFinder 1 1.000 - - FOG0001122
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R242
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.