DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OXA1L and cox18

DIOPT Version :9

Sequence 1:NP_648417.1 Gene:OXA1L / 39222 FlyBaseID:FBgn0027615 Length:441 Species:Drosophila melanogaster
Sequence 2:XP_021336627.1 Gene:cox18 / 100000948 ZFINID:ZDB-GENE-080204-88 Length:332 Species:Danio rerio


Alignment Length:302 Identity:74/302 - (24%)
Similarity:124/302 - (41%) Gaps:61/302 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 AAGEPSFASIGL-----------GGW-------SPVGMVQNCLEFLHCTWDIPWWGTIAIGTLAV 163
            |:..||..||..           .||       :||...:..|..:.....:|||.:|...|||:
Zfish    22 ASLRPSLISISQCGSFRAVSTQGSGWYESVADSAPVHQAEQLLLSVQQLTGLPWWSSIICTTLAL 86

  Fly   164 R-TIIFPLVILAQRNSAKMNNNMPQM----QMLQLKMTEARQSGNAIESA----------RYAQE 213
            | :|..||.|......||:.....::    |.|:.:::...:..|..|..          |...|
Zfish    87 RCSITLPLAIYQAHIIAKIEALQKEIAAFAQQLRFEISVRAKEKNWTEQTCRFHFKKNLRRIVSE 151

  Fly   214 MMLFMREKGVNPLKNMVVPLAQAPLFISFFMGLRQMA----NAPV-----ESMRDGGLFWFTDLT 269
              |::|| ..:|.|..|:...|.|:::...:.||.::    |..|     ..:..||..||.|||
Zfish   152 --LYVRE-NCHPFKASVLIWVQLPMWVCVSLALRNLSLGLGNTDVCECLAAGLAAGGALWFPDLT 213

  Fly   270 MADPFYLLPLITSATLYLTIEI----GTDSARLSAANMNTMKYV---LRALPIVIFPFTMNFPAA 327
            :.|..:::|:.......|..||    .|:|:::       .||.   :|.:.:::.|.....|::
Zfish   214 VPDSTWIMPVSLGIINLLITEIFALRQTESSKM-------QKYATHFIRGISVLMIPIAATVPSS 271

  Fly   328 ILTYWACSNFISLGQVAVLRIPSVREYFKIEKMLTHAPSALP 369
            :..||..|:.:.|....:||.|.||:..:|.:  |...|..|
Zfish   272 MCVYWLSSSCVGLAHNLLLRSPGVRKLCRIPE--TRFDSQTP 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OXA1LNP_648417.1 yidC_oxa1_cterm 152..342 CDD:274665 54/220 (25%)
cox18XP_021336627.1 60KD_IMP <62..305 CDD:321001 62/254 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D495015at33208
OrthoFinder 1 1.000 - - FOG0001122
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.