DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galla-2 and CIA2

DIOPT Version :9

Sequence 1:NP_648416.1 Gene:galla-2 / 39221 FlyBaseID:FBgn0036107 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_011990.1 Gene:CIA2 / 856522 SGDID:S000001164 Length:231 Species:Saccharomyces cerevisiae


Alignment Length:149 Identity:79/149 - (53%)
Similarity:99/149 - (66%) Gaps:14/149 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 ERVLTANEEDENV---------PDPFDKREIFDLIRNINDPEHPLTLEELHVVQEDLIRINDSQN 73
            |..|.|..|||:|         ||..|.:||:|||.:|:||||||:|.:|.||..:.|.::||.|
Yeast    79 EDSLPAESEDESVAGGGKEEEEPDLIDAQEIYDLIAHISDPEHPLSLGQLSVVNLEDIDVHDSGN 143

  Fly    74 -----SVHISFTPTIPHCSMATLIGLSIRVKLLRSLPPRFKVTVEITPGTHASELAVNKQLADKE 133
                 .|.|..||||.|||:||||||.|||:|.|||||||::|:.:..|||.||..|||||.|||
Yeast   144 QNEMAEVVIKITPTITHCSLATLIGLGIRVRLERSLPPRFRITILLKKGTHDSENQVNKQLNDKE 208

  Fly   134 RVAAALENNHLAEVINQCI 152
            |||||.||..|..|:::.:
Yeast   209 RVAAACENEQLLGVVSKML 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galla-2NP_648416.1 DUF59 1..154 CDD:294611 79/149 (53%)
CIA2NP_011990.1 COG5133 1..231 CDD:227462 79/149 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345356
Domainoid 1 1.000 92 1.000 Domainoid score I1737
eggNOG 1 0.900 - - E1_COG5133
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6115
Inparanoid 1 1.050 139 1.000 Inparanoid score I1187
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001710
OrthoInspector 1 1.000 - - oto99943
orthoMCL 1 0.900 - - OOG6_102398
Panther 1 1.100 - - LDO PTHR12377
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1897
SonicParanoid 1 1.000 - - X2577
TreeFam 1 0.960 - -
1413.780

Return to query results.
Submit another query.