DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galla-2 and Ciao2b

DIOPT Version :9

Sequence 1:NP_648416.1 Gene:galla-2 / 39221 FlyBaseID:FBgn0036107 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_081029.1 Gene:Ciao2b / 68523 MGIID:1915773 Length:163 Species:Mus musculus


Alignment Length:151 Identity:109/151 - (72%)
Similarity:131/151 - (86%) Gaps:0/151 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IENINPNVYDRIKERVLTANEEDENVPDPFDKREIFDLIRNINDPEHPLTLEELHVVQEDLIRIN 69
            :||.||.:|:|..||.:||.||||.|||..|.||||||||:|||||||||||||:||::..|:::
Mouse    12 LENANPLIYERSGERPVTAGEEDEEVPDSIDAREIFDLIRSINDPEHPLTLEELNVVEQVRIQVS 76

  Fly    70 DSQNSVHISFTPTIPHCSMATLIGLSIRVKLLRSLPPRFKVTVEITPGTHASELAVNKQLADKER 134
            |.:::|.::||||||||||||||||||:||||||||.|||:.|.|||||||||.|||||||||||
Mouse    77 DPESTVAVAFTPTIPHCSMATLIGLSIKVKLLRSLPQRFKMDVHITPGTHASEHAVNKQLADKER 141

  Fly   135 VAAALENNHLAEVINQCIAAK 155
            |||||||.||.||:|||::|:
Mouse   142 VAAALENTHLLEVVNQCLSAR 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galla-2NP_648416.1 DUF59 1..154 CDD:294611 108/148 (73%)
Ciao2bNP_081029.1 FeS_assembly_P <23..161 CDD:382298 102/137 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845923
Domainoid 1 1.000 117 1.000 Domainoid score I5878
eggNOG 1 0.900 - - E1_COG5133
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6115
Inparanoid 1 1.050 224 1.000 Inparanoid score I3501
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54279
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001710
OrthoInspector 1 1.000 - - oto94324
orthoMCL 1 0.900 - - OOG6_102398
Panther 1 1.100 - - LDO PTHR12377
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1897
SonicParanoid 1 1.000 - - X2577
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.790

Return to query results.
Submit another query.