DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galla-2 and Ciao2b

DIOPT Version :9

Sequence 1:NP_648416.1 Gene:galla-2 / 39221 FlyBaseID:FBgn0036107 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_001138326.1 Gene:Ciao2b / 680987 RGDID:1585802 Length:165 Species:Rattus norvegicus


Alignment Length:151 Identity:109/151 - (72%)
Similarity:131/151 - (86%) Gaps:0/151 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IENINPNVYDRIKERVLTANEEDENVPDPFDKREIFDLIRNINDPEHPLTLEELHVVQEDLIRIN 69
            :||.||.:|:|..||.:||.||||.|||..|.||||||||:|||||||||||||:||::..|:::
  Rat    14 LENANPLIYERSGERPVTAGEEDEEVPDSIDAREIFDLIRSINDPEHPLTLEELNVVEQVRIQVS 78

  Fly    70 DSQNSVHISFTPTIPHCSMATLIGLSIRVKLLRSLPPRFKVTVEITPGTHASELAVNKQLADKER 134
            |.:::|.::||||||||||||||||||:||||||||.|||:.|.|||||||||.|||||||||||
  Rat    79 DPESTVAVAFTPTIPHCSMATLIGLSIKVKLLRSLPQRFKMDVHITPGTHASEHAVNKQLADKER 143

  Fly   135 VAAALENNHLAEVINQCIAAK 155
            |||||||.||.||:|||::|:
  Rat   144 VAAALENTHLLEVVNQCLSAR 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galla-2NP_648416.1 DUF59 1..154 CDD:294611 108/148 (73%)
Ciao2bNP_001138326.1 FeS_assembly_P <25..163 CDD:412662 102/137 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166349353
Domainoid 1 1.000 118 1.000 Domainoid score I5739
eggNOG 1 0.900 - - E1_COG5133
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6115
Inparanoid 1 1.050 225 1.000 Inparanoid score I3417
OMA 1 1.010 - - QHG54279
OrthoDB 1 1.010 - - D1408004at2759
OrthoFinder 1 1.000 - - FOG0001710
OrthoInspector 1 1.000 - - oto97843
orthoMCL 1 0.900 - - OOG6_102398
Panther 1 1.100 - - LDO PTHR12377
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2577
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.