DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galla-2 and ciao2b

DIOPT Version :9

Sequence 1:NP_648416.1 Gene:galla-2 / 39221 FlyBaseID:FBgn0036107 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_001128276.1 Gene:ciao2b / 548360 XenbaseID:XB-GENE-5959878 Length:160 Species:Xenopus tropicalis


Alignment Length:153 Identity:108/153 - (70%)
Similarity:130/153 - (84%) Gaps:0/153 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TEIENINPNVYDRIKERVLTANEEDENVPDPFDKREIFDLIRNINDPEHPLTLEELHVVQEDLIR 67
            :::||.||.:|.|..||.:||.||||:.||..|.||||||||.|||||||||||||:||:|..::
 Frog     5 SQLENANPLIYRRAGERQVTAQEEDEDAPDRIDDREIFDLIRCINDPEHPLTLEELNVVEEIRVK 69

  Fly    68 INDSQNSVHISFTPTIPHCSMATLIGLSIRVKLLRSLPPRFKVTVEITPGTHASELAVNKQLADK 132
            ::|.:::|.:.||||||||||||||||||:||||||||.||||.|.|||||||||.|||||||||
 Frog    70 VSDEESTVSVEFTPTIPHCSMATLIGLSIKVKLLRSLPERFKVDVHITPGTHASEHAVNKQLADK 134

  Fly   133 ERVAAALENNHLAEVINQCIAAK 155
            |||||||||:||.||:|||::.:
 Frog   135 ERVAAALENSHLLEVVNQCLSGR 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galla-2NP_648416.1 DUF59 1..154 CDD:294611 108/150 (72%)
ciao2bNP_001128276.1 FeS_assembly_P 5..154 CDD:382298 107/148 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 108 1.000 Domainoid score I6389
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H6115
Inparanoid 1 1.050 212 1.000 Inparanoid score I3558
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1408004at2759
OrthoFinder 1 1.000 - - FOG0001710
OrthoInspector 1 1.000 - - oto104536
Panther 1 1.100 - - O PTHR12377
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1897
SonicParanoid 1 1.000 - - X2577
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.190

Return to query results.
Submit another query.