DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galla-2 and AT3G50845

DIOPT Version :9

Sequence 1:NP_648416.1 Gene:galla-2 / 39221 FlyBaseID:FBgn0036107 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_001078267.1 Gene:AT3G50845 / 5008077 AraportID:AT3G50845 Length:154 Species:Arabidopsis thaliana


Alignment Length:146 Identity:71/146 - (48%)
Similarity:101/146 - (69%) Gaps:3/146 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 NINPNVYDRIKERVLTANEEDENVPDPFDKREIFDLIRNINDPEHPLTLEELHVVQEDLIRINDS 71
            |.||.|..: ||.::  ..||:...|..|..||:|.:|:|.|||||.|||:|.||.|:.:.::|.
plant     7 NANPVVQAK-KEGLV--RREDQYRDDGVDPLEIYDYVRDIRDPEHPYTLEQLRVVSEESVTVDDK 68

  Fly    72 QNSVHISFTPTIPHCSMATLIGLSIRVKLLRSLPPRFKVTVEITPGTHASELAVNKQLADKERVA 136
            .:.:.|:|||||.|||||.:|||.:|.||...|...:||.:.::||:||.|::|||||.|||||.
plant    69 LDRILITFTPTIQHCSMANIIGLCLRAKLKECLQLHYKVDIRVSPGSHADEVSVNKQLNDKERVV 133

  Fly   137 AALENNHLAEVINQCI 152
            |||||.:|.:::::||
plant   134 AALENPNLRQLVDECI 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galla-2NP_648416.1 DUF59 1..154 CDD:294611 71/146 (49%)
AT3G50845NP_001078267.1 DUF59 <29..149 CDD:294611 61/119 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5133
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 171 1.000 Inparanoid score I1533
OMA 1 1.010 - - QHG54279
OrthoDB 1 1.010 - - D1408004at2759
OrthoFinder 1 1.000 - - FOG0001710
OrthoInspector 1 1.000 - - otm3039
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12377
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2577
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.940

Return to query results.
Submit another query.